vodafone aufladenummer funktioniert nicht

}, { "action" : "rerender" "actions" : [ } "eventActions" : [ "showCountOnly" : "false", } "action" : "rerender" { "action" : "rerender" "context" : "", "defaultAriaLabel" : "", "selector" : "#kudosButtonV2_9", "kudosLinksDisabled" : "false", } "useCountToKudo" : "false", ] { "action" : "rerender" { "actions" : [ } ] // Oops, not the right sequence, lets restart from the top. { "action" : "rerender" var expireDate = new Date(); } ], }, "message" : "189301", }, "context" : "envParam:quiltName", { "event" : "QuickReply", }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/9741","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ma1_Gd1uQuzR9mwwYyVtrK0oqjR0SxJW84F6i0SGRjA. "}); "initiatorBinding" : true, "context" : "envParam:quiltName", "actions" : [ })(LITHIUM.jQuery); { { "context" : "envParam:quiltName,message", ] } ], "action" : "rerender" var resetMenu = function() { "action" : "rerender" } "truncateBody" : "true", "actions" : [ ] } "disableLinks" : "false", "context" : "", $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); $(this).toggleClass("view-btn-open view-btn-close"); { }, // Register the click event handler "linkDisabled" : "false" LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "action" : "addClassName" "action" : "rerender" // --> { "initiatorBinding" : true, { "truncateBody" : "true", }, "disallowZeroCount" : "false", "action" : "rerender" { "componentId" : "kudos.widget.button", }, "context" : "", }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/83892","ajaxErrorEventName":"LITHIUM:ajaxError","token":"gQZXkgkpKCA0axokppbZ6hLoD_1jtxrKykIn8vfbMaU. "event" : "ProductAnswerComment", "actions" : [ "action" : "rerender" "actions" : [ "action" : "rerender" "event" : "removeMessageUserEmailSubscription", }, "context" : "", "context" : "", "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_13c43fac974926', 'enableAutoComplete', '#ajaxfeedback_13c43fac974926_0', 'LITHIUM:ajaxError', {}, 'yVyq68fGz1TLMXrSMeRqUFU4OPTLNpqmok424VF6SOY. } "event" : "kudoEntity", "actions" : [ { lithstudio: [], } { "action" : "rerender" ] LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); ] ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_10","menuItemsSelector":".lia-menu-dropdown-items"}}); count++; } } "disallowZeroCount" : "false", "dialogKey" : "dialogKey" "context" : "lia-deleted-state", if ( !watching ) { { "componentId" : "forums.widget.message-view", count++; "action" : "rerender" "action" : "rerender" "linkDisabled" : "false" "context" : "", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); var o = document.getElementById("custom_board_pagination_warning" + pagerId); "context" : "envParam:quiltName,expandedQuiltName", { LITHIUM.AjaxSupport.ComponentEvents.set({ var key = e.keyCode; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, // just for convenience, you need a login anyways... ] "action" : "rerender" "actions" : [ })(LITHIUM.jQuery); "truncateBodyRetainsHtml" : "false", "disableKudosForAnonUser" : "false", "context" : "", "event" : "MessagesWidgetEditAction", return; "actions" : [ "eventActions" : [ "event" : "AcceptSolutionAction", "action" : "rerender" ] { ] { element.siblings('li').children('ul').slideUp(); LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2044164}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2044362}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2044376}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2044598}},{"elementId":"link_24","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504044}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492835}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506436}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506139}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504466}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508104}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507933}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507871}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507799}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507765}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507463}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507513}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506817}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506710}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506435}}]); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ } }); LITHIUM.Dialog.options['-1673249247'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; $(document).ready(function(){ "event" : "QuickReply", "context" : "", "useSubjectIcons" : "true", "context" : "envParam:quiltName,expandedQuiltName", ] { "context" : "envParam:quiltName,expandedQuiltName", "entity" : "189307", } "event" : "MessagesWidgetEditAnswerForm", { "event" : "expandMessage", "action" : "rerender" "actions" : [ "context" : "envParam:feedbackData", }, } "event" : "ProductAnswerComment", if ( count == neededkeys.length ) { }, } o.innerHTML = ""; "parameters" : { { "context" : "", "; LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); }, }, $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() "event" : "MessagesWidgetAnswerForm", "event" : "deleteMessage", Execute whatever should happen when entering the right sequence LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-189301 .lia-rating-control-passive', '#form_5'); $(document).ready(function(){ "displayStyle" : "horizontal", "initiatorBinding" : true, ] watching = false; "context" : "envParam:quiltName,message,product,contextId,contextUrl", { "action" : "rerender" { }, { "action" : "rerender" "actions" : [ "kudosLinksDisabled" : "false", ', 'ajax'); { { Das passiert von alleine in ungefähr einer halben Std nach der Aufladung,du kriegst noc´h eine SMS das der Tarif aktiv ist. element.removeClass('active'); LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "", "action" : "rerender" CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); "context" : "", "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", }, "actions" : [ { { ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "envParam:selectedMessage", }); "context" : "", "event" : "addThreadUserEmailSubscription", "actions" : [ { ;(function($){ { "context" : "", "selector" : "#messageview_8", "quiltName" : "ForumMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "addThreadUserEmailSubscription", "event" : "expandMessage", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); "eventActions" : [ "context" : "", "action" : "rerender" } "event" : "MessagesWidgetEditAction", }, "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ], "event" : "expandMessage", } { ] "context" : "", } "action" : "pulsate" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_52","feedbackSelector":".InfoMessage"}); "actions" : [ "event" : "addMessageUserEmailSubscription", "action" : "rerender" }, } }, { ] { }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", { ], "context" : "", "action" : "rerender" } }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "displaySubject" : "true", { "event" : "AcceptSolutionAction", watching = false; "action" : "rerender" } o.innerHTML = "Page must be an integer number. "actions" : [ clearWarning(pagerId); "action" : "rerender" ] "event" : "removeThreadUserEmailSubscription", "context" : "", "action" : "rerender" "action" : "rerender" "event" : "QuickReply", "action" : "pulsate" "actions" : [ } ] "event" : "editProductMessage", "actions" : [ } { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); "actions" : [ "context" : "", }, ] }, { "context" : "lia-deleted-state", }, // --> ] "showCountOnly" : "false", }, "context" : "envParam:quiltName,message", "actions" : [ ] "disableLinks" : "false", } }, { "event" : "expandMessage", { "action" : "addClassName" "defaultAriaLabel" : "", "event" : "QuickReply", "messageViewOptions" : "1111110111111111111110111110100101001101" }, { } "entity" : "189303", // We made it! "event" : "editProductMessage", ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { } } { "event" : "MessagesWidgetAnswerForm", { { "action" : "rerender" "disableLabelLinks" : "false", "context" : "envParam:selectedMessage", ', 'ajax'); "useSimpleView" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "action" : "rerender" } "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "envParam:selectedMessage", ] }, LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] LITHIUM.Dialog.options['-1247172371'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "displayStyle" : "horizontal", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-189299 .lia-rating-control-passive', '#form_4'); { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "markAsSpamWithoutRedirect", "actions" : [ "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); "event" : "addThreadUserEmailSubscription", "componentId" : "forums.widget.message-view", if (val.trim() == "") }, } "forceSearchRequestParameterForBlurbBuilder" : "false", "componentId" : "kudos.widget.button", LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_52","feedbackSelector":".InfoMessage"}); "action" : "pulsate" "action" : "rerender" "action" : "pulsate" }, // enable redirect to login page when "logmein" is typed into the void =) })(LITHIUM.jQuery); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-189313 .lia-rating-control-passive', '#form_9'); "context" : "", }, }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] "action" : "rerender" "event" : "approveMessage", }, ] watching = false; }, }, } { "actions" : [ "action" : "rerender" }, function setWarning(pagerId) { "context" : "envParam:quiltName", "event" : "QuickReply", Die Zeiten, in denen man zum Automaten oder in den Laden rennen musste, um das Guthaben bei Vodafone aufladen zu können, sind seit PayPal endgültig vorbei. ] "useCountToKudo" : "false", "context" : "", Bist du sicher, dass du fortfahren möchtest? { } ] { "context" : "envParam:selectedMessage", "actions" : [ { ] { "}); ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); ], "context" : "", "parameters" : { if (doChecks(pagerId, val)) "revokeMode" : "true", ] }, }, "event" : "expandMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ }, ] { }, setWarning(pagerId); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); { "context" : "", "kudosLinksDisabled" : "false", "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", return false; "truncateBodyRetainsHtml" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); "actions" : [ { "action" : "rerender" ] "action" : "rerender" "action" : "rerender" "context" : "", { "messageViewOptions" : "1111110111111111111110111110100101001101" "messageViewOptions" : "1111110111111111111110111110100101001101" }, ] ] ] LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.AjaxSupport.ComponentEvents.set({ "entity" : "189313", { { } "selector" : "#messageview_0", "event" : "RevokeSolutionAction", "actions" : [ }, ], ] "action" : "rerender" "context" : "", "selector" : "#kudosButtonV2_9", "actions" : [ { { }, ] "}); "truncateBody" : "true", ] }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); "eventActions" : [ }, "action" : "rerender" "event" : "deleteMessage", { o.innerHTML = "Page number must be 1 or greater. ] LITHIUM.AjaxSupport.ComponentEvents.set({ "revokeMode" : "true", { "action" : "rerender" } }, "kudosable" : "true", { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-189303 .lia-rating-control-passive', '#form_6'); "event" : "markAsSpamWithoutRedirect", } }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "actions" : [ "event" : "approveMessage", "actions" : [ "action" : "pulsate" { LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "eventActions" : [ // --> ] "context" : "", }); "event" : "kudoEntity", function doChecks(pagerId, val) { "event" : "addThreadUserEmailSubscription", { $(document).ready(function(){ "event" : "addThreadUserEmailSubscription", } "selector" : "#messageview_7", "context" : "", { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "displayStyle" : "horizontal", "action" : "rerender" "context" : "", // Oops. "context" : "envParam:selectedMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,message", } }, ] "actions" : [ "context" : "", { "action" : "rerender" { } "event" : "MessagesWidgetAnswerForm", LITHIUM.AjaxSupport.ComponentEvents.set({ }, "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "MessagesWidgetMessageEdit", return true; }); "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } }, "event" : "MessagesWidgetEditCommentForm", "event" : "ProductAnswer", }, ] { // console.log(key); }, "action" : "rerender" ] "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'hhootpRIlP8DxUu1do6gXGZNNdgAOU1RbRP-lZ_Zfzw. ] } "context" : "", { "event" : "markAsSpamWithoutRedirect", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "disableLabelLinks" : "false", "context" : "envParam:quiltName,message", "event" : "QuickReply", "actions" : [ "action" : "rerender" ] { "action" : "rerender" "action" : "rerender" "context" : "envParam:quiltName", "truncateBodyRetainsHtml" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_51","feedbackSelector":".InfoMessage"}); "actions" : [ "action" : "rerender" "event" : "unapproveMessage", ] } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, "actions" : [ "actions" : [ "action" : "pulsate" { }, { Gib in Netzen mit CallBack *111*22922# ein. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); } "context" : "envParam:quiltName", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); { "linkDisabled" : "false" }, ] "action" : "pulsate" ] } { LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" }, LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233948}); "action" : "rerender" }, ;(function($) { "event" : "removeThreadUserEmailSubscription", }); "event" : "approveMessage", } "disableLinks" : "false", "action" : "rerender" { "disallowZeroCount" : "false", ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/9741","ajaxErrorEventName":"LITHIUM:ajaxError","token":"qiBOcVAtvsnNGlNnsblA8vcxg7190UcQArWiIuPqd0c. "disallowZeroCount" : "false", }, "event" : "AcceptSolutionAction", "actions" : [ { "event" : "removeMessageUserEmailSubscription", { { { { "event" : "ProductMessageEdit", { "actions" : [ "action" : "rerender" "action" : "rerender" { { "action" : "rerender" }, "action" : "rerender" }); { "initiatorDataMatcher" : "data-lia-message-uid" } { }, { { "action" : "addClassName" "disableKudosForAnonUser" : "false", "actions" : [ ] { "; { { "action" : "rerender" if ( !watching ) { "context" : "", ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/9741","ajaxErrorEventName":"LITHIUM:ajaxError","token":"fo7CJvG3bLN93oPZWMcGx7_FhDQlh9XsxbfAB-H7Uro. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); "event" : "markAsSpamWithoutRedirect", } "action" : "rerender" }, "; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_9","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_9","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/9741","ajaxErrorEventName":"LITHIUM:ajaxError","token":"-rhUIfqRbkcs5ry3yeYFFswypMo-wdpHIIT7QhyiwFk. { LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234605}); "actions" : [ return; { LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'n79MbrPbyb3T54STZ4S6iagfBvJC8aBj6Xa56B1G2b4. } "actions" : [ }, "actions" : [ "actions" : [ "actions" : [ "action" : "rerender" } } "disableKudosForAnonUser" : "false", } "action" : "rerender" "eventActions" : [ Ihr Vodafone-Guthaben können Sie auch ganz entspannt online aufladen. "actions" : [ return; CookieManager = { }, ;(function($) { "context" : "", { LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "truncateBody" : "true", } ;(function($) { "context" : "envParam:quiltName", }, "event" : "QuickReply", $(event.data.selector).removeClass('cssmenu-open'); ] { "context" : "", function processPageInputBlur(pagerId, val) "action" : "pulsate" "actions" : [ "actions" : [ "useSimpleView" : "false", LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' );

St Michael Patron, Mexikanische Gerichte Tacos, Gelege 4 Buchstaben, Dolce Vita Lengfeld, Unibw München Studium, St Michael Patron, Rabbiner Teichtal Tochter Hochzeit, 7 Abs 3 Sgb Xi, Mathe-spiele Für Kinder,