prepaid guthaben nicht gutgeschrieben

} "action" : "rerender" window.location = "https://forum.vodafone.de/t5/Archiv-CallYa/CallYa-Guthaben-wurde-nicht-gutgeschrieben-oder-doch/td-p/1667751" + "/page/" + val; } LITHIUM.AjaxSupport.fromLink('#kudoEntity_9', 'kudoEntity', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {}, 'w7vDxmItLQ9AdxyKQiaW1tQ-6b2wyYAAxe_C3n0gMg8. "action" : "rerender" { }, "selector" : "#kudosButtonV2_9", "context" : "", }, "revokeMode" : "true", { "event" : "editProductMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); "actions" : [ ] } }); "action" : "rerender" "actions" : [ watching = true; ] if (isNaN(val) ) "truncateBodyRetainsHtml" : "false", { "event" : "kudoEntity", } "context" : "envParam:quiltName,message,product,contextId,contextUrl", } "event" : "expandMessage", "event" : "expandMessage", "event" : "editProductMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); $(document).ready(function(){ } "event" : "MessagesWidgetEditAction", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "message" : "1671935", "event" : "addMessageUserEmailSubscription", "action" : "rerender" { "action" : "rerender" "context" : "envParam:entity", { ] } { { "context" : "envParam:feedbackData", beschwerde wurde von Aldi Talk nicht angenommen zu einem Supervisior konnte er mich auch nicht verbinden das ist abzoge…. "event" : "kudoEntity", } }, ] { ] ] ] "action" : "rerender" "event" : "editProductMessage", "event" : "ProductAnswerComment", { "actions" : [ "action" : "rerender" }, { { "event" : "ProductAnswer", } "context" : "", "actions" : [ { } "context" : "", return true; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_52","feedbackSelector":".InfoMessage"}); }, ] "action" : "rerender" }, ] "event" : "ProductAnswerComment", "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "action" : "rerender" }, { "message" : "1668939", { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); }, LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); var notifCount = 0; }, }, } "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] // --> { ] "message" : "1671935", "event" : "addThreadUserEmailSubscription", }, }, } $('#custom-overall-notif-count').html(notifCount); } ] LITHIUM.InputEditForm("form_9", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61457","ajaxErrorEventName":"LITHIUM:ajaxError","token":"MK8zM2h2A4-xw9kk7_BiI3YQyL4bd6_9ZRU9PxyoUcE. "useTruncatedSubject" : "true", Beschwerte Fehlanzeige angeblich soll ich 1Stunde im Internet Gewesen sein obwohl Datenreaktiviert waren. { { { "disableLabelLinks" : "false", ] "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { // enable redirect to login page when "logmein" is typed into the void =) { { "actions" : [ "action" : "rerender" { { "context" : "lia-deleted-state", LITHIUM.Dialog({ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "actions" : [ "actions" : [ } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); { Wir versenden den Newsletter dabei kostenfrei. { "truncateBody" : "true", $(document).ready(function(){ "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_9","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_9","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61457","ajaxErrorEventName":"LITHIUM:ajaxError","token":"NFRBxsUcOpNDTF_E2L8Xh3JohVLUoDj5cBJf5elDEPk. "actions" : [ { Dies ist jedoch nur bei den folgenden Banken möglich. "actions" : [ ] } "actions" : [ "context" : "", "context" : "", { //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); "truncateBodyRetainsHtml" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "actions" : [ "actions" : [ } }, "truncateBodyRetainsHtml" : "false", } }, "context" : "", ] "actions" : [ "context" : "", LITHIUM.Dialog.options['-244757137'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "action" : "rerender" "actions" : [ "event" : "addThreadUserEmailSubscription", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); if ( neededkeys[count] == key ) { ] setWarning(pagerId); "context" : "", { }, } "context" : "", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "event" : "addThreadUserEmailSubscription", "action" : "rerender" "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" { "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, "forceSearchRequestParameterForBlurbBuilder" : "false", "entity" : "1672428", "disableLinks" : "false", "event" : "MessagesWidgetCommentForm", } ;(function($) { { { }, clearWarning(pagerId); { { ] LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "event" : "MessagesWidgetCommentForm", "event" : "MessagesWidgetEditCommentForm", "context" : "envParam:feedbackData", { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61457","ajaxErrorEventName":"LITHIUM:ajaxError","token":"NOFFbpM8ceJboArk4l3CL4cx02Dy8L4KbyiCqJ3itN0. } "context" : "envParam:quiltName,expandedQuiltName", } "action" : "rerender" "actions" : [ "event" : "MessagesWidgetEditAction", "componentId" : "forums.widget.message-view", } }, Mehr zu mir und meinem Hintergrund: Die wichtigsten Themen auf prepaid-deutschland.de direkt verlinkt: Die wichtigsten Themenbereiche auf prepaid-deutschland.de direkt verlinkt: Prepaidkarten sind zwar sehr flexibel, stellen aber rechtlich gesehen trotzdem ein Vertragsverhältnis dar und haben somit bestimmte Rechte und Pflichten für den Kunden. } "actions" : [ { // If watching, pay attention to key presses, looking for right sequence. }, LITHIUM.AjaxSupport.ComponentEvents.set({ } } { ] { "eventActions" : [ ], "truncateBodyRetainsHtml" : "false", "context" : "envParam:feedbackData", $(document).ready(function(){ "context" : "", window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":998,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFcKAVNRA1cFBxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVcBQNQAFxQVRRUV1cDSQEGVwRIDwQOCk9SVlJQVgIGXFADCQBAThUPVn1bVgB\/AhsIQCNFB11aQm0mVwpVawNAG0ZeUGZXFkIwC2MXB0UdFwkWYSB6I3pmQgtTRHNhe39FWwNKQQMFUhcVZHx3N3NGTV0SC1RKXFcJDUV6L3R7NkIIRkhO"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { } ] "useTruncatedSubject" : "true", { "actions" : [ ] LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "envParam:entity", }, "action" : "rerender" { if ( Number(val) > 3 ) "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", { "context" : "", "action" : "rerender" } ] { "event" : "MessagesWidgetEditAnswerForm", $(document).ready(function(){ { "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "event" : "MessagesWidgetCommentForm", ] } { } }, "action" : "rerender" "action" : "rerender" { }, "includeRepliesModerationState" : "false", "context" : "envParam:quiltName,message", { "action" : "rerender" Darüber hinaus steht hier das FAX zur Verfügung, das an Vodafone gesendet werden kann um die Drittanbietersperre einzurichten: Drittanbietersperre-Vodafone (PDF), Bei O2 kann die Sperre von Drittanbietern nur über die Kundenhotline eingerichtet werden Dabei sind drei Varianten der Sperrung möglich: Komplettsperre inklusive o2, nur Drittanbieter (ohne O2), nur Drittanbieter ohne (mypass und O2), Prepaid Vergleich: Anbieter mit viel Startguthaben, Prepaid ohne Bankkonto und Bankverbindung – diese Anbieter gibt es. } }, ] } { }); { } } { var count = 0; { }); { }, "defaultAriaLabel" : "", } "actions" : [ "action" : "rerender" { "action" : "rerender" }, "context" : "lia-deleted-state", }, ] "event" : "MessagesWidgetMessageEdit", { } } "event" : "ProductAnswerComment", "actions" : [ LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); "action" : "rerender" "event" : "addThreadUserEmailSubscription", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] { { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, LITHIUM.Dialog.options['-244757137'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] { "activecastFullscreen" : false, "actions" : [ "disallowZeroCount" : "false", "action" : "rerender" "actions" : [ }, { ] "messageViewOptions" : "1111110111111111111110111110100101101101" "event" : "addMessageUserEmailSubscription", })(LITHIUM.jQuery); "context" : "", "context" : "envParam:selectedMessage", "context" : "", }); }); "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", } } { }, "useTruncatedSubject" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); ] "disableLabelLinks" : "false", "event" : "unapproveMessage", { }, "action" : "rerender" "quiltName" : "ForumMessage", { }, } "action" : "rerender" LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; { "action" : "rerender" "event" : "removeThreadUserEmailSubscription", } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "markAsSpamWithoutRedirect", "entity" : "1670043", "context" : "", } "action" : "rerender" }, { LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "QuickReply", { Ich habe einen geschäftlichen Mobilfunkvertrag (!) ] }, "context" : "", "actions" : [ "actions" : [ { "actions" : [ }, Anschließend wählen Sie den Betrag aus und geben die Handynummer an, zu … } "context" : "", } "context" : "", } "event" : "MessagesWidgetEditAction", "displayStyle" : "horizontal", Ich werde mich telefonisch bei Aldi beschweren und wenn dabei nichts geklärt werden kann, werde ich einen Anwalt einschalten. ] "event" : "markAsSpamWithoutRedirect", "event" : "ProductAnswer", { ] } "action" : "rerender" } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61457","ajaxErrorEventName":"LITHIUM:ajaxError","token":"6QV9e7E-K6vwPqpkhw3Z_lVyCI4ExecCulgCKkuMBNU. "actions" : [ "triggerEvent" : "click", ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } "initiatorBinding" : true, $(document).ready(function(){ "action" : "rerender" { LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "disableLabelLinks" : "false", "event" : "MessagesWidgetAnswerForm", "context" : "", { { { ] var watching = false; "revokeMode" : "true", "eventActions" : [ "componentId" : "kudos.widget.button", }, { LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "event" : "addThreadUserEmailSubscription", }, ] LITHIUM.AjaxSupport.useTickets = false; ] function setWarning(pagerId) { "actions" : [ "action" : "rerender" } "event" : "removeThreadUserEmailSubscription", } ] "useSubjectIcons" : "true", disableInput(pagerId); { "event" : "QuickReply", } "event" : "MessagesWidgetMessageEdit", "action" : "pulsate" vor 11 Monaten 11 Januar 2020. "event" : "addMessageUserEmailSubscription", { }, "context" : "envParam:quiltName", "truncateBody" : "true", }, "selector" : "#kudosButtonV2_9", var count = 0; "revokeMode" : "true", "action" : "rerender" "displaySubject" : "true", LITHIUM.AjaxSupport.useTickets = false; }); "useCountToKudo" : "false", "context" : "envParam:quiltName", "context" : "envParam:entity", "actions" : [ ', 'ajax'); { "action" : "pulsate" "event" : "MessagesWidgetEditCommentForm", "actions" : [ "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61457","ajaxErrorEventName":"LITHIUM:ajaxError","token":"h_3O-m3_I9AAAAzbilSYLwW_4eqXpTNnyyKJSC47OHQ. Also die 100€ werden nicht als Guthaben aufgebucht sondern automatisch monatlich verrechnet. "actions" : [ "actions" : [ "useTruncatedSubject" : "true", o.innerHTML = "Page must be in a numeric format. "action" : "rerender" { ', 'ajax'); // console.log('watching: ' + key); "action" : "rerender" if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", clearWarning(pagerId); "actions" : [ "; }, "action" : "rerender" "actions" : [ } } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "event" : "expandMessage", !Ich glaube das ist es auch das Problem bei meisten Kommentaren hier! { Januar dann die tolle Überraschung: Meldung, men Guthaben betrage nur noch einen Franken!!! "action" : "pulsate" "context" : "", "accessibility" : false, "selector" : "#messageview_7", { Jeder Mobilfunkanbieter sperrt nach einer gewissen Zeit einen ungenutzten Prepaid … { und mehrere PrePaid Verträge, aber das scheint noch nicht auszureichen, um hier einen vernünftigen Service zu bekommen. { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "includeRepliesModerationState" : "false", } "; })(LITHIUM.jQuery); "event" : "QuickReply", "eventActions" : [ "context" : "lia-deleted-state", } }, }, ] { }, "dialogContentCssClass" : "lia-panel-dialog-content", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_51","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "context" : "envParam:entity", "actions" : [ }, "truncateBodyRetainsHtml" : "false", } } "actions" : [ ] ] "truncateBodyRetainsHtml" : "false", "actions" : [ "event" : "MessagesWidgetEditAction", { { createStorage("false"); }, }, }, }, "event" : "ProductAnswerComment", }, "initiatorBinding" : true, } setWarning(pagerId); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); $(this).removeAttr('href'); "action" : "rerender" } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" "actions" : [ { "actions" : [ } "action" : "rerender" { "action" : "rerender" var o = document.getElementById("custom_board_pagination_warning" + pagerId); "event" : "ProductMessageEdit", "context" : "envParam:quiltName,message", "event" : "MessagesWidgetMessageEdit", { "useCountToKudo" : "false", "useCountToKudo" : "false", } LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); "context" : "", "entity" : "1670043", "disableKudosForAnonUser" : "false", "actions" : [ { { "action" : "addClassName" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "actions" : [ "action" : "rerender" // --> { "event" : "MessagesWidgetEditCommentForm", "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'iSRSJc0dyJwRKMCn-HfPPZ-j1AX8F0bFU-AW6QiGmzI. "event" : "RevokeSolutionAction", } "messageViewOptions" : "1111110111111111111110111110100101001101" { "parameters" : { return; "event" : "MessagesWidgetEditCommentForm", } }, }, })(LITHIUM.jQuery); "actions" : [ "event" : "unapproveMessage", "context" : "envParam:quiltName", "action" : "rerender" "context" : "", Bist du sicher, dass du fortfahren möchtest? "event" : "MessagesWidgetEditCommentForm", } "actions" : [ }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); "action" : "rerender" { "actions" : [ "actions" : [ ] "actions" : [ "actions" : [ { ] "eventActions" : [ { "actions" : [ "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", { if (isNaN(val) ) LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); { } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "envParam:selectedMessage", "quiltName" : "ForumMessage", "action" : "rerender" { Bist du sicher, dass du fortfahren möchtest? } "context" : "envParam:quiltName", { }, { "context" : "envParam:feedbackData", "event" : "markAsSpamWithoutRedirect", }, ] var msg = $(".message-uid-1971904"); }, { "actions" : [ { { }, }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "pulsate" "actions" : [ // just for convenience, you need a login anyways... Bei Problemen oder Fragen - einfach die Kommentare nutzen oder micht direkt anschreiben. { { ] "event" : "MessagesWidgetCommentForm", "event" : "ProductAnswerComment", } "event" : "kudoEntity", } if ( !watching ) { "actions" : [ "actions" : [ ] { "eventActions" : [ }, }, { clearWarning(pagerId); } ], "useCountToKudo" : "false", {

Soße Selber Machen Ohne Mehl, Geschicklichkeitsspiel Selber Machen, Modergeruch 4 Buchstaben, Wie Viel Verdient Man Bei Pro Familia, Lenovo Ac Adapter 65w 20v, Divino Nordheim Stellenangebote, Telegram Nachrichten Kommen Nicht An, Mexikaner Wien 1020,